← Catalog

Tesamorelin

Trans-3-hexenoyl GRF 1-44 amide

Full-length human GHRH with a hexenoyl group that protects its N-terminus.

Vial size

GHRH and secretagoguesHPLC · MS · Endotoxin

Tesamorelin 2 mg research vial

What it is

Tesamorelin is the complete 44-residue human GHRH amide with a trans-3-hexenoyl group on the N-terminal tyrosine. The group protects the peptide from cleavage by DPP-4.

What researchers study

  • Agonist at the GHRH receptor.
  • Used to study GHRH receptor signaling and growth hormone secretion.

Specifications

Sequence(trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular formulaC221H366N72O67S
Molecular weight5135.8 g/mol
PubChemCID 16137828
FormLyophilized powder
Vial sizes2 mg, 5 mg
StorageUnopened: 2 to 8 °C, away from light

How each lot is tested

Samples from every lot go to an independent, ISO/IEC 17025 accredited lab. Its report covers three tests:

  • Purity by reversed-phase HPLC: the main peak's share of the total peak area.
  • Identity by mass spectrometry: the observed mass should match the expected 5135.8 g/mol.
  • Endotoxin, measured for every lot.

The lot number on your vial is the number on its report. How to check a certificate of analysis walks through what to look for.

The amount on the label is the weight of the powder. Besides the peptide it includes counter-ions and some water; Purity vs. peptide content explains the difference.

Storage and handling

Store unopened vials at 2 to 8 °C, away from light, as printed on the label. Let a cold vial reach room temperature before you open it, so moisture doesn't condense on the powder. More bench habits are in Handling.

For laboratory research use only. Not for human or veterinary use. This page describes the compound and published research on it. It is not a recommendation for any use.